PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 452aa    MW: 51739.7 Da    PI: 5.8901
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626689.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.22.6e-43591862128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppG+rF+Ptd+elv++yLk+k+++ +l   + i e++iyk+ P+ + +  k ++eekewy  ++rd+ky++g+r+nra+ +gyWkatg dke+++
  XP_009626689.1  59 PPGYRFKPTDSELVTYYLKRKLDKLPLYP-NRIYEINIYKYSPELIAAhvKPTTEEKEWYVLTPRDRKYKNGNRPNRAAGDGYWKATGADKEIKD 152
                     9*************************888.67**************85235556889************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +k+  +glkk+Lv+y g+ pkg kt+W+mheyr+
  XP_009626689.1 153 NKNVIIGLKKSLVYYIGKPPKGDKTNWIMHEYRV 186
                     9999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-5254213IPR003441NAC domain
PROSITE profilePS5100551.24958213IPR003441NAC domain
PfamPF023659.7E-2559186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MENHHSSSRP TNNANISKGN LTDQRPINEL PVTAVLSNNN NNGEITSAEE IEAYINSFPP  60
GYRFKPTDSE LVTYYLKRKL DKLPLYPNRI YEINIYKYSP ELIAAHVKPT TEEKEWYVLT  120
PRDRKYKNGN RPNRAAGDGY WKATGADKEI KDNKNVIIGL KKSLVYYIGK PPKGDKTNWI  180
MHEYRVPDAP NLVERDINDW KLDEWVMCRI YKKSDRDNPM FTQRKRIRDA YETKTGRGNS  240
NDSDQDFNND VQVGESSDGN LSNDFANITF EAASQDSTRH DSINCIQDTL HSNNRVPIFH  300
PQVPTRFGNF PKSCVPEFCD MPWSTTTSAY DYQRCVPGFN EGFVTYDKFH YPPSPMKIEP  360
ISSMMAISNL MEQDMKSNGF GDIPCFSSCI GGYMGQDYEY MGLEKLGSGE YIDHYLVNCE  420
MENSTMYLPE YNMKNLVNGE SSQSKTSSIS GK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-475721316165NO APICAL MERISTEM PROTEIN
1ut4_B1e-475721316165NO APICAL MERISTEM PROTEIN
1ut7_A1e-475721316165NO APICAL MERISTEM PROTEIN
1ut7_B1e-475721316165NO APICAL MERISTEM PROTEIN
4dul_A1e-475721316165NAC domain-containing protein 19
4dul_B1e-475721316165NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626689.10.0PREDICTED: NAC domain-containing protein 19-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139361213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-54NAC domain containing protein 25